Public Pricelist
  1. All Products
  2. FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mG.

FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mG.

https://peptide.genprice.com/web/image/product.template/39757/image_1920?unique=3006b3e

2,249.00 € 2249.0 EUR 2,249.00 €

$ 2,249.00

Not Available For Sale

    This combination does not exist.

    Contact Us

    Terms and Conditions
    30-day money-back guarantee
    Shipping: 2-3 Business Days

    Website URL: /shop/0399-csb-dt0293-500mg-fvnqhlsgshlvealylvsgergffytpka-synthetic-peptide-purity-98-500mg-39757
    Internal Reference: 0399-CSB-DT0293-500mG.

    How Does Human Metapneumovirus (hMPV) Compare to COVID-19?